Protein Info for AO353_10240 in Pseudomonas fluorescens FW300-N2E3

Annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 PF04321: RmlD_sub_bind" amino acids 4 to 143 (140 residues), 45.1 bits, see alignment E=2.2e-15 PF01370: Epimerase" amino acids 6 to 228 (223 residues), 163.6 bits, see alignment E=1.7e-51 PF16363: GDP_Man_Dehyd" amino acids 38 to 291 (254 residues), 175.2 bits, see alignment E=7.9e-55 PF07993: NAD_binding_4" amino acids 55 to 159 (105 residues), 30.3 bits, see alignment E=7.4e-11 PF01073: 3Beta_HSD" amino acids 55 to 143 (89 residues), 25.1 bits, see alignment E=2.6e-09

Best Hits

Swiss-Prot: 75% identical to RMD_PSEAE: GDP-6-deoxy-D-mannose reductase (rmd) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_5681)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WTY2 at UniProt or InterPro

Protein Sequence (304 amino acids)

>AO353_10240 NAD-dependent dehydratase (Pseudomonas fluorescens FW300-N2E3)
LKKRLFVTGLSGFVGRHIQSRLNSSDSGWELSPVPSRYDLCEPKSLDGLWPHMPDAVIHL
AGQTFVPEAFRDPAKTFQVNLLGTLNLLQALKARGFNGTFLYVSSGDVYGEVSESALPID
ERQPPCPRNPYAVSKLSAEMLCLQWGMTEGWPVLVARPFNHIGTGQLDSFVIASAARQIC
RIKLGLQAPELEVGDIDVTRDFLDVRDVVSAYLALLACGTPGQVYNICSGVEQSIRALIE
QLADLAQVDMQLIQDPARLRRAEQRRVRGSHAKLHQTTGWAPELTTQQSLRAILSDWESR
VRQE