Protein Info for AO353_09050 in Pseudomonas fluorescens FW300-N2E3

Annotation: recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF02899: Phage_int_SAM_1" amino acids 5 to 88 (84 residues), 77.3 bits, see alignment E=9.2e-26 TIGR02224: tyrosine recombinase XerC" amino acids 7 to 293 (287 residues), 353.2 bits, see alignment E=6.2e-110 PF00589: Phage_integrase" amino acids 110 to 279 (170 residues), 155.3 bits, see alignment E=1.4e-49

Best Hits

Swiss-Prot: 91% identical to XERC_PSEFL: Tyrosine recombinase XerC (xerC) from Pseudomonas fluorescens

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 91% identity to pba:PSEBR_a5487)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WTG7 at UniProt or InterPro

Protein Sequence (299 amino acids)

>AO353_09050 recombinase XerC (Pseudomonas fluorescens FW300-N2E3)
MERQLDAYCEHLRSERQVSSHTLEAYRRDLNKVLAHCKKQNIGSWTALDIQRLRSLIARL
HSQGQSSRSLARLLSAVRGLYHYLNREGLCDHDPANGLAPPKGERRLPKTLDTDRALQLL
DGAVEDDFMARRDQAILELFYSSGLRLSELTGLNLEQLDLADGLVQVLGKGSKTRVLPVG
KKAREALELWLPLRAMANPVDDAVFVSQKGRRLGSRAVQARVKAVGERELGQNLHPHMLR
HSFASHLLESSQDLRAVQELLGHADIKTTQIYTHLDFQHLASVYDSAHPRAKRIKGDEQ