Protein Info for AO353_08800 in Pseudomonas fluorescens FW300-N2E3

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 211 to 240 (30 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 25 to 364 (340 residues), 137.3 bits, see alignment E=1.1e-43 PF01061: ABC2_membrane" amino acids 181 to 336 (156 residues), 95.2 bits, see alignment E=6.4e-31 PF12679: ABC2_membrane_2" amino acids 185 to 368 (184 residues), 54.7 bits, see alignment E=1.5e-18

Best Hits

Swiss-Prot: 51% identical to YHHJ_SHIFL: Inner membrane transport permease YhhJ (yhhJ) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 90% identity to pfl:PFL_5975)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WGY8 at UniProt or InterPro

Protein Sequence (372 amino acids)

>AO353_08800 hypothetical protein (Pseudomonas fluorescens FW300-N2E3)
MHKLAHILRLGLKEMSSLQHDSVLLLFLLYAFTVAIYMPAAGSVIGVHNASVAIVDEDHS
NLSRQLAQSLQPPEFQRPVLLPYGQLDQVMDSGQYTFVINVPASFQADMLAGRQPAVQVN
VDATAMSQAFMGAGYIARIFQRELLSYNDQSDPTGKAPALLTTRSLFNTNLEGGWFLAVI
QIVNNITILAIILTGTALLREREHGTLDHLLVLPLTALEIMLAKIWSNMLVVVLCTWASL
EIIVKGALGVPLAGSMALFLLVTAVYLFASTALGIFLATLARSTPQFGLLAIPVIIPMLL
LSGGSTPLDSMPQWLQWVMQGSPSTHFVSLSAAILFRDAGVSVVWPDLLALSAIGLLFFA
IALKRFRKSLAS