Protein Info for AO353_08050 in Pseudomonas fluorescens FW300-N2E3

Annotation: 16S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR00046: RNA methyltransferase, RsmE family" amino acids 18 to 237 (220 residues), 220.5 bits, see alignment E=1e-69 PF20260: PUA_4" amino acids 19 to 63 (45 residues), 47.8 bits, see alignment 1.2e-16 PF04452: Methyltrans_RNA" amino acids 74 to 233 (160 residues), 182.6 bits, see alignment E=4.5e-58

Best Hits

Swiss-Prot: 48% identical to RSME_DICD3: Ribosomal RNA small subunit methyltransferase E (rsmE) from Dickeya dadantii (strain 3937)

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 91% identity to pba:PSEBR_a5292)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFS0 at UniProt or InterPro

Protein Sequence (239 amino acids)

>AO353_08050 16S rRNA methyltransferase (Pseudomonas fluorescens FW300-N2E3)
MRLSRFFIDAPLSLGEHELPEAQAHYISRVLRMAEGDALQVFDGSGQEFRGTLAEVGKKR
VRVALTESFAGQIESPLQIHLGQGLSRGERMDWAIQKATELGVTEITPIFSDRCEVRLKD
ERADKRLQHWRQVAISACEQCGRSRVPVIHPPLLLADWLKQSEAELKLVLHPVAEPLVSH
AKPSTLAFLIGPEGGLSDVEVDQAQSAGFHSARLGPRVLRTETAPVVALAVAQQLWGDF