Protein Info for AO353_07800 in Pseudomonas fluorescens FW300-N2E3

Annotation: transcriptional repressor BetI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 TIGR03384: transcriptional repressor BetI" amino acids 2 to 192 (191 residues), 254.2 bits, see alignment E=3.6e-80 PF00440: TetR_N" amino acids 14 to 59 (46 residues), 33.6 bits, see alignment 2.6e-12 PF13977: TetR_C_6" amino acids 84 to 191 (108 residues), 102 bits, see alignment E=2.4e-33

Best Hits

Swiss-Prot: 95% identical to BETI_PSEPF: HTH-type transcriptional regulator BetI (betI) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02167, TetR/AcrR family transcriptional regulator, transcriptional repressor of bet genes (inferred from 95% identity to pfo:Pfl01_5242)

Predicted SEED Role

"HTH-type transcriptional regulator BetI" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WDR6 at UniProt or InterPro

Protein Sequence (201 amino acids)

>AO353_07800 transcriptional repressor BetI (Pseudomonas fluorescens FW300-N2E3)
MPKVGMQPIRRQQLIEATLQAVDRVGMGDASIALIARLAGVSNGIISHYFQDKNGLIAAT
MRYLMSVLSENVTARRLALGDNSPRAHLQVIIEGNFDASQVNGPAMKTWLAFWATSMHQP
SLHRLQRINDHRLYSNLCCEFRRVLPLDQARNAARGLAALIDGLWLRGALSGDAFDTEQA
QRIAYEYMDIQLAKQELLEHT