Protein Info for AO353_07155 in Pseudomonas fluorescens FW300-N2E3

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR01850: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 2 to 344 (343 residues), 439.9 bits, see alignment E=3.5e-136 PF01118: Semialdhyde_dh" amino acids 3 to 142 (140 residues), 129.6 bits, see alignment E=1.8e-41 PF03807: F420_oxidored" amino acids 3 to 100 (98 residues), 23.4 bits, see alignment E=1.5e-08 PF22698: Semialdhyde_dhC_1" amino acids 150 to 312 (163 residues), 192.6 bits, see alignment E=9.5e-61 PF02774: Semialdhyde_dhC" amino acids 161 to 315 (155 residues), 73.2 bits, see alignment E=6.4e-24

Best Hits

Swiss-Prot: 98% identical to ARGC_PSEPF: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 97% identity to pfl:PFL_5611)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WF92 at UniProt or InterPro

Protein Sequence (344 amino acids)

>AO353_07155 N-acetyl-gamma-glutamyl-phosphate reductase (Pseudomonas fluorescens FW300-N2E3)
MVKVGIVGGTGYTGVELLRLLAQHPQAEVVVITSRSEAGLAVADMYPNLRGHYDGLAFSV
PDIKTLGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDADEWAKWYGQPHGA
PELLEEAVYGLPEVNREQIRQARLIAVPGCYPTATQLGFLPLLEAGLADTSRLIADCKSG
VSGAGRGASVGSLYSETSESMKAYAVKGHRHLPEIRQGLRRAAGKDVGLTFVPHLTPMIR
GIHSTLYATVVDRSIDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQD
GDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERLGLSHAGMLP