Protein Info for AO353_04690 in Pseudomonas fluorescens FW300-N2E3

Annotation: hemolysin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 159 to 178 (20 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details PF07238: PilZ" amino acids 16 to 116 (101 residues), 45 bits, see alignment E=2.4e-15 PF25964: BSH_ALG44" amino acids 200 to 294 (95 residues), 129.7 bits, see alignment E=6.5e-42 PF25891: Hl_ALG44" amino acids 232 to 258 (27 residues), 58.8 bits, see alignment (E = 8e-20) PF25965: Beta-barrel_ALG44" amino acids 298 to 377 (80 residues), 122.6 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 72% identical to ALG44_PSESM: Alginate biosynthesis protein Alg44 (alg44) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 85% identity to pfo:Pfl01_0958)

MetaCyc: 57% identical to mannuronosyl transferase regulatory subunit (Pseudomonas aeruginosa)
Alginate synthase. [EC: 2.4.1.33]

Predicted SEED Role

"Alginate biosynthesis protein Alg44"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WFI6 at UniProt or InterPro

Protein Sequence (389 amino acids)

>AO353_04690 hemolysin D (Pseudomonas fluorescens FW300-N2E3)
MNTAANINVVHESEAQRQHARVKIPAKLRFFGPDRTPVDARLIDLSAGGLSFNAGQVLLK
VGDVHKGRLQFLIDNLGLAMDVEIQIRSFDRQTGRTGCQFQNLEPQDISTLRHLITSHLS
GDIVTMGDVLATLQRDNFTKARKLKDGGHGMSAFGRLRAVTFSLGIFVVGLAAFGFVFKS
VYGMYFVSHAQAGLVSVSGMNVTMPRDGTVQSLIKTDGVAAKGAPLATFSTSMLDVLKGH
LDENQLQPAKVEELFGKQMTGTLTSPCDCTVAQQMVADGQYASKGDVIFKLVPQGSQASV
EARFSYRQFADVRPGTKVSFQIAGEDATRTGTIVSSTSLKSEDLSSDIRVQIKPDAPLDS
TFAGRPAEVSSNRGPSLNWLIDKAMAAGL