Protein Info for AO353_04430 in Pseudomonas fluorescens FW300-N2E3

Annotation: DNA mismatch repair protein MutT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 166 to 183 (18 residues), see Phobius details PF00293: NUDIX" amino acids 26 to 113 (88 residues), 43.6 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 44% identical to NUDL_ENT38: Uncharacterized Nudix hydrolase NudL (nudL) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 96% identity to pfo:Pfl01_1010)

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9VQB8 at UniProt or InterPro

Protein Sequence (199 amino acids)

>AO353_04430 DNA mismatch repair protein MutT (Pseudomonas fluorescens FW300-N2E3)
MLDELLHRVSNHTPRTLETDLRFPEAAVLVPITRSDEPELVLTLRASGLSTHGGEVAFPG
GRRDPEDPDLIFTALREAEEEIGLPPGLVEVIGPLSPLISLHGIKVTPYVGVIPDFVEYR
ANDAEIAAVFSVPLEFFRKDPREHTHRIDYQGRSWYVPSYRFGEYKIWGLTAIMIVELIN
LLYDAQISLHQPPKNFINI