Protein Info for AO353_02520 in Pseudomonas fluorescens FW300-N2E3

Annotation: sodium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 126 to 150 (25 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 282 to 303 (22 residues), see Phobius details PF13593: SBF_like" amino acids 34 to 304 (271 residues), 86.7 bits, see alignment E=1.9e-28 PF01758: SBF" amino acids 42 to 219 (178 residues), 156.7 bits, see alignment E=5.7e-50

Best Hits

Swiss-Prot: 55% identical to YOCS_BACSU: Uncharacterized sodium-dependent transporter YocS (yocS) from Bacillus subtilis (strain 168)

KEGG orthology group: K03453, bile acid:Na+ symporter, BASS family (inferred from 94% identity to pfo:Pfl01_1667)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9WQ08 at UniProt or InterPro

Protein Sequence (321 amino acids)

>AO353_02520 sodium transporter (Pseudomonas fluorescens FW300-N2E3)
MRALAALSRFVGNTFAYWVLIFAVVAFLQPAWFIGLKGAIVPLLGLVMFGMGLTLKLEDF
AEVARHPWRVALGVVAHFVIMPGVAWLLCQAFHLPPEIAVGVILVGCCPSGTSSNVMTWL
ARGDLALSVAIAAVTTLLAPVLTPALIWLLASAWLPVSFMELFWSILQVVLLPIVLGVVA
QRLLEDRVRHAVEVLPLVSVVSIVIIVAAVVAASQAKIAESGLLIMAVVMLHNSFGFLLG
YFTGRVFKLPLAQRKSLALEVGMQNSGLGAALASAHFSPLAAVPSALFSVWHNISGALLS
TYFRRMSEKQDRELAARQATE