Protein Info for AO353_00395 in Pseudomonas fluorescens FW300-N2E3

Annotation: thiamine biosynthesis protein ApbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF02424: ApbE" amino acids 23 to 303 (281 residues), 265.1 bits, see alignment E=3.7e-83

Best Hits

Swiss-Prot: 38% identical to APBE1_KLEP3: FAD:protein FMN transferase (apbE1) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03734, thiamine biosynthesis lipoprotein (inferred from 75% identity to pfo:Pfl01_3863)

MetaCyc: 36% identical to FAD:protein FMN transferase (Escherichia coli K-12 substr. MG1655)
RXN-14461 [EC: 2.7.1.180]

Predicted SEED Role

"Thiamin biosynthesis lipoprotein ApbE"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0N9W1G3 at UniProt or InterPro

Protein Sequence (328 amino acids)

>AO353_00395 thiamine biosynthesis protein ApbE (Pseudomonas fluorescens FW300-N2E3)
VLVGALSGCGNSDTLESFGGPTMGSTYSVKYIRHPGTPGPVEVQKQVESILAEIDRQLST
YRSDSDIERFNGLPANSCQPMPAPVLQLVKVGEQLSETSAGSYDLTVEPLLNLWGFGPQS
RDEKIPSAEALALARQRVGYTHLRIEGDQLCKDAPVEVDFGSIGAGYAVDRIAAKLQEMG
IDSFIADATGELKAVGKKLDGSPWKIALEEPRDDQQVVERVIALDGNGVSTSGDYRNYFM
QDGRRYSHTFDARTGAPITHTLASVTVINPSTLMADGLSTLLLILGPERGWDYAEKHDIG
AFFVIRADTGFVTRTSQAFDRLSAEKAK