Protein Info for ABZR87_RS23475 in Ralstonia sp. UNC404CL21Col

Annotation: malonate decarboxylase subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details TIGR03131: malonate decarboxylase, epsilon subunit" amino acids 3 to 289 (287 residues), 313.6 bits, see alignment E=7.2e-98 PF00698: Acyl_transf_1" amino acids 5 to 277 (273 residues), 85.3 bits, see alignment E=2.9e-28

Best Hits

KEGG orthology group: K13935, malonate decarboxylase epsilon subunit [EC: 2.3.1.39] (inferred from 84% identity to rpf:Rpic12D_3871)

Predicted SEED Role

"Malonyl CoA acyl carrier protein transacylase (EC 2.3.1.39)" in subsystem Malonate decarboxylase (EC 2.3.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.39

Use Curated BLAST to search for 2.3.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>ABZR87_RS23475 malonate decarboxylase subunit epsilon (Ralstonia sp. UNC404CL21Col)
MSILFMFPGQGSQRAGMLRALPDDPVVAQTLTEAGDVLGVDPLTIDTAEALRSTVAVQLC
LLIAGAAVARTLARQDAGPDMVAGLSIGAWPAAVLAGVLEFSDALRLVRLRAQLMEDAYP
SGYGMVAIIGLAEPEVSGIVAQVDATATPAYVANVNAERQIVVAGNDAALARVAERALAH
GASKATRLCMAVPSHCPLLDAQAAELATAAAKVTAHAPQLTYVSSSRARALFRANLIVED
LAWNMARPVLWHDTLRHALERGANMAVEVPGGGTLARLAQGVFAAEAVLDAGAGLDAVRV
RIQRQRRGDGL