Protein Info for ABZR87_RS23215 in Ralstonia sp. UNC404CL21Col

Annotation: D-xylose ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 31 to 288 (258 residues), 225.5 bits, see alignment E=9e-71 TIGR02634: D-xylose ABC transporter, D-xylose-binding protein" amino acids 31 to 333 (303 residues), 476.8 bits, see alignment E=1.7e-147 PF00532: Peripla_BP_1" amino acids 52 to 244 (193 residues), 31.4 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 58% identical to XYLF_ECOLI: D-xylose-binding periplasmic protein (xylF) from Escherichia coli (strain K12)

KEGG orthology group: K10543, D-xylose transport system substrate-binding protein (inferred from 94% identity to rpf:Rpic12D_3836)

MetaCyc: 58% identical to xylose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-33-RXN [EC: 7.5.2.10, 7.5.2.13]

Predicted SEED Role

"Xylose ABC transporter, periplasmic xylose-binding protein XylF" in subsystem Xylose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.10 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABZR87_RS23215 D-xylose ABC transporter substrate-binding protein (Ralstonia sp. UNC404CL21Col)
MISRVLNTLAAAAVLTFAATSAHASKEAPVIGFSIDDLRVERWTHDRDYFIESAKKLGAT
VNVQSANANEAKQIAQIENLIAQNVDVLVIVPFNSKVLGNAIASAKKKGIKVVSYDRLIL
NADIDGYVTFDNVKVGELQAQGVVKLAPKGNYFLLGGAATDNNARLLREGQMKVLKPYVD
KGDIKIVGEQWTPEWDPSKAQNIVENALTANNNNIQGIVASNDGTAGGAIQALARQKLAG
KVPVSGQDADLAAVKRVAEGTQAMTVYKPIKQIAATAAEMAVDLVKGTAPKFNTKLNNGK
KDVDTVLLTPTLLTKDNLDSTVVKDGFYTHQQIFGK