Protein Info for ABZR87_RS22960 in Ralstonia sp. UNC404CL21Col

Annotation: heme-copper oxidase subunit III family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 41 to 232 (192 residues), 75.9 bits, E=2.5e-25

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 87% identity to rsl:RPSI07_mp1671)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Protein Sequence (232 amino acids)

>ABZR87_RS22960 heme-copper oxidase subunit III family protein (Ralstonia sp. UNC404CL21Col)
MSHSTLPTDPAVSADAAKGWPGIVNDWSADRETFKVPWGKAMMWIFLLSDTFVFSSFLVG
YMTVRMSTTVPWPDPSKVFGLSVGGVEVPLLLIAIMTFVLISSSGTMAMAVNFGYRREAK
RAALLMLATAILGAAFVSMQAFEWTKLIVHEGIRPWGNPLGAAQFGACFFMITGFHGFHV
TCGVIYLLLVARKILQPGFAEHGNFQIVEIAGLYWHFVDLVWVFIFALFYLW