Protein Info for ABZR87_RS22765 in Ralstonia sp. UNC404CL21Col

Annotation: urea ABC transporter permease subunit UrtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 13 to 304 (292 residues), 387.7 bits, see alignment E=2.2e-120 PF02653: BPD_transp_2" amino acids 16 to 290 (275 residues), 121.4 bits, see alignment E=1.9e-39

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 87% identity to hse:Hsero_2634)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>ABZR87_RS22765 urea ABC transporter permease subunit UrtB (Ralstonia sp. UNC404CL21Col)
MTSLSEFGAIFAMQGFNGLSFFCVLLLMALGLAIIFGQMGVINMAHGEFLTIGAYTTYLL
STLTASYAPALQPYYFFAAVVLSFVLAAAIGYAVERLMISRLYNRPLDTLLATWGLSLAM
QQAFRSIFGAKEVSPALPDWLMGSFSPGGGIDIPINGLFVMALTTLLTGALFLLLFRSRW
GLQVRATVQNRVMSGAVGIDTRRVDRMTFALGCGVAGVAGAAFTTIGSTGPTSGSLYIVD
TFLVVVFGGAQSLLGTIASAFTIAQTQSTTEFFLTGSMAKVLTLSAVILILMMRPQGLFS
VKVRK