Protein Info for ABZR87_RS22755 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1132 transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 74 to 97 (24 residues), see Phobius details amino acids 118 to 147 (30 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 259 to 288 (30 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 428 to 451 (24 residues), see Phobius details amino acids 458 to 477 (20 residues), see Phobius details amino acids 574 to 594 (21 residues), see Phobius details amino acids 614 to 634 (21 residues), see Phobius details PF00512: HisKA" amino acids 680 to 746 (67 residues), 60 bits, see alignment 2.9e-20 PF02518: HATPase_c" amino acids 794 to 901 (108 residues), 90.8 bits, see alignment E=1.2e-29 PF00072: Response_reg" amino acids 926 to 1036 (111 residues), 81.4 bits, see alignment E=8.1e-27

Best Hits

KEGG orthology group: None (inferred from 69% identity to bxe:Bxe_B1712)

Predicted SEED Role

"Two-component hybrid sensor and regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1132 amino acids)

>ABZR87_RS22755 ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MHQSGTQRIVKIRRDYNTWVADETLEDYALRYTPRGFRKWSEFRVANTALGATSFLALEA
IGGSLAINYGFTNAFWAIVVVSVLIFLTGLPISYYAARFGVDMDLLTRGAGFGYIGSTVT
SLVYATFTFIFLALEAAIMALAVQLYVGLPLPIAYVLCSLVIIPLVTHGITAINKLQSWT
QVLWLVLLVLPYAAVLLRNPRAFADWPSFGGLSESGRDFNLLAFGAGCTVAFALIVQIGE
QVDYLRFLPEKTRANRGKWWLALLAAGPGWVVPGALKMLGGSFLVFLAVQHEVGTARAVE
PTQMYLVAYQYVFGSPALAMAAMALFVVVSQIKINVTNAYAGSLAWSNFFARLTHSHPGR
VVWLVFNVLIALLLMELGVFEALSEVLALYANVAIAWIGALVADLVINKPLGYSPAHIEF
KRAYLYDVNPVGVGAMLIASVVATLAHLGLFGAVTEALSPFVALGMAFLCAPLIAVATRG
RFYLARKVHAPADAEHAHAGAMRCVICENVFEREDMAHCPAYAGSICSLCCSLDARCGDA
CKPHGRLSAQIAQAWRHWFPNTELPRLHVRVAQYAAVLLIVLGLLAGVLTLIYYQTAVTL
SADQSPLQLLARGYIKAFFALALVGCVGAWWLVLAKESRKVAQEESNRQTMLLMREIEAH
RKTDAMLQQAKQAAESANRAKSRYVTGLSHELRTPLNSILGYAQLLMRDPSMAPARREGL
ATIFRSGEHLLALVDGLLDVARIEAGKLQLDVSQVAFPAFLTQIEAMMEPHASEKGLAFR
MEHVGRIPDAVRMDEKRVRQILINLLGNAVRFTESGTVSLRVAYARELATFEILDTGIGI
ASDELERIFLPFERGAAAHAQDNGAGLGLTICRMLTTLMGGQLSVDSVPGEGTRFTVRLF
LPEVREPRAVDRIRHVSGYRGARRTVLVVDDQREQRRIVVGALAPLGFTLVEAASGPEAM
RQLGALQVDLIVMDVSMPSMDGFEASRLIRKQALSVAPILVLSANAFAGDRARGAAAGCD
DYLAKPVHLPHLLDKVGELLNLEWIVDSEAGAEAPPPARSHAPLPAELVAQLRPLLEIGY
IRGLIELLDEAEHRHPDLAGALQPVRSAARRFRLTELDRLLKGAPSDEHSVD