Protein Info for ABZR87_RS22630 in Ralstonia sp. UNC404CL21Col

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF00106: adh_short" amino acids 98 to 285 (188 residues), 169 bits, see alignment E=1.3e-53 PF08659: KR" amino acids 99 to 277 (179 residues), 31.2 bits, see alignment E=3e-11 PF13561: adh_short_C2" amino acids 104 to 336 (233 residues), 206.7 bits, see alignment E=6.4e-65

Best Hits

Swiss-Prot: 61% identical to YGHA_ECO57: Uncharacterized oxidoreductase YghA (yghA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 73% identity to bmu:Bmul_5540)

MetaCyc: 61% identical to NADP+-dependent aldehyde reductase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>ABZR87_RS22630 SDR family oxidoreductase (Ralstonia sp. UNC404CL21Col)
MADDDFFKARRKVMQGATAALAAAVTTPALAQSQSQPAAAAGAASAKSGVQDPRPLYPHP
PFPVQSQPWPGLAARMTPRPDHGERSYRGNGRLTGRRALITGGDSGIGRAAAIAFAREGA
DVAINYLPQEEEDAREVVELIRAAGRKAVALPGDIRDEAFCKSLVDKAVSALGGLDILVN
NAGRQQSHDSILDITTDAFDWTLKTNVYALFWITKAAIPHMPAGAAIINTASVNAYDPSE
NLLDYACTKAAIANFTKGLAKQMAKRGIRVNAVAPGPFWTPLQVSGGQTEANLKEFGAKT
PMGRPGQPAEIATVYVQLASSESSYVTGQVYGASGGSGQP