Protein Info for ABZR87_RS22590 in Ralstonia sp. UNC404CL21Col

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 794 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 186 to 206 (21 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 1 to 161 (161 residues), 35.1 bits, see alignment E=2.1e-12 PF00672: HAMP" amino acids 204 to 257 (54 residues), 39.2 bits, see alignment 1.4e-13 PF01627: Hpt" amino acids 431 to 510 (80 residues), 32.5 bits, see alignment E=1.7e-11 PF02518: HATPase_c" amino acids 623 to 758 (136 residues), 40.8 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 87% identity to rpf:Rpic12D_3757)

Predicted SEED Role

"Signal transduction histidine kinase CheA (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (794 amino acids)

>ABZR87_RS22590 ATP-binding protein (Ralstonia sp. UNC404CL21Col)
MTIRHRITLLVVLMFVALAAIGGYAVYQTRGSAAEVRQVTEGVVPSALASADLVSLVKDV
QLATMVLVYAPDANIVAQAKDDLKAKEAALRAALDVQAKRANSHAQEGLVAQAKESVDSY
VEAIQQTTDMKLAGKDELAQAFLFANVASYRDVLEKIVETLRIEKNREKDEAIAGLNGKL
ASTATTIGVVSGVAVVLLTAIGMLLYRQITRPLTRMQAEMSEIAASQDFTRRVPVGRMDE
IGHSVVAFNQMIEKIQENAALLKQKTADIQAMLQNMQQGILTVVEGGVVHEEYSVYLESI
FETQAIAGRRLMELIFADTSLGADTLSQVEAAVDACLGQDIINFAFNQHLLVSEVEKRMP
DGRTKTLDLSWSAITDESDTILRLMLCVRDVTELRKLAAEASEQRRNLEMIGEILAVSQE
KFQHFIDSSTTFVHENERIIRQYSQADSAAIAALFRNMHTIKGNARTYNLQHLTNVVHET
EQTYHALREPDGERTWDQDWLMEELARVREAIENYARLNEVKLGRKGDGSPGQAMQAAPD
VTTRIQESLRLLESANPANLHELVAMRDSVHQQLRLLCSETVDALLSGALQSLPSLAQEL
GKESVAVRIDDNGYRVRTEARSILQNVFTHLLRNSIDHGIEPADERIAHGKPAAGTIDIE
VGVDQGMLQITLCDDGRGLALDRIRSIAVERGWIGADQHASDEDIAQYIFRPGFSTADKV
TEVSGRGVGMDAVQAFLQREQGRIELRFTDDRKGAAFRQFQTVVCLPERFAVDSVNATLS
APPAVRMDLDKEAS