Protein Info for ABZR87_RS22550 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 397 to 414 (18 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 322 (292 residues), 119.9 bits, see alignment E=5.9e-39

Best Hits

KEGG orthology group: None (inferred from 87% identity to rpi:Rpic_4825)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>ABZR87_RS22550 MFS transporter (Ralstonia sp. UNC404CL21Col)
MTTAMCLPATATPMSRHHRWKVLGVGVAANASFSAAFSGIPTTAVFIRSAYHLGNAELGV
ALGALGLGIAISELPWGLLTDRWGDRTVLLAGLGLTALALFVMACCVVPLHGNVPPLAWL
VGGMLSVGLLGGSVNGSSGRAVMGWFREGERGLAMSIRQTAVPLGGGIGALVLPSLAAHA
GFAAVYGVLAAACALTAVLTWLWVHDAPDMVNAVAQAATPGKTGPLRDPTLLRMALAIGL
LCVPQGAVVAFATVFLRDFAHANVLTLSLTMAAVQGGAAVMRVWSGRWTDRHGNRRAYLL
ACARLSVALFVVLAGVAWMTSALSVDLSVMRVALVAAVVAGGICVSAWHGVGYTELATLA
GAQRAGTALGLGNTGAFAALGLTSLCLPQVLAWSSWPVVWLVAAGSALIAWRVLPAQRP