Protein Info for ABZR87_RS22525 in Ralstonia sp. UNC404CL21Col

Annotation: 3-oxoacyl-ACP reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 19 to 179 (161 residues), 58.1 bits, E=2.3e-19
• PF00106: adh_short
  • amino acids 19 to 209 (191 residues), 193.1 bits, E=7.3e-61
• PF01370: Epimerase
  • amino acids 21 to 182 (162 residues), 23.9 bits, E=5e-09
• PF13561: adh_short_C2
  • amino acids 27 to 256 (230 residues), 222.8 bits, E=9.7e-70

Best Hits

Swiss-Prot: 38% identical to NODG_AZOBR: Nodulation protein G (nodG) from Azospirillum brasilense

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 90% identity to rpi:Rpic_4824)

MetaCyc: 42% identical to L-xylo-3-hexulose reductase (Aspergillus niger ATCC 1015)
1.1.1.-

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (19/20 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (5/5 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• D-galactose degradation IV (1/3 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.3.1.10

Protein Sequence (257 amino acids)

>ABZR87_RS22525 3-oxoacyl-ACP reductase family protein (Ralstonia sp. UNC404CL21Col)
MSETQTTPSTNAQRLAGRTAIVTGGSRGIGAAVAHRLAADGARVAVVYRSNAAEADAVVN
SIRTTGAQAIAVQADVSDAPSVDAMVSIVREAFGAIDILVNNAGILENQPVGSIDLASFD
TQFRTNAFSTILVTQAVLPHVPARGGHIVNVSSSLVYRPRAGLAVYAASKAAVSALTHAF
AIELGPRNITVNAVAPALTRTDMTAPIPDEVKARMRESTPMGRLAEPEDIADAIAFLASD
DARWITGRTLMTDGGFI