Protein Info for ABZR87_RS22045 in Ralstonia sp. UNC404CL21Col

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 69 to 86 (18 residues), see Phobius details PF13302: Acetyltransf_3" amino acids 21 to 157 (137 residues), 32.7 bits, see alignment E=2.9e-11 PF13420: Acetyltransf_4" amino acids 21 to 175 (155 residues), 44.5 bits, see alignment E=4.2e-15 PF13673: Acetyltransf_10" amino acids 46 to 160 (115 residues), 25.1 bits, see alignment E=3.9e-09 PF00583: Acetyltransf_1" amino acids 52 to 156 (105 residues), 56.8 bits, see alignment E=6.7e-19 PF13508: Acetyltransf_7" amino acids 71 to 158 (88 residues), 35 bits, see alignment E=3.7e-12

Best Hits

Swiss-Prot: 54% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 80% identity to rpf:Rpic12D_3647)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>ABZR87_RS22045 GNAT family N-acetyltransferase (Ralstonia sp. UNC404CL21Col)
MSSAMPIDASRSVRESGAVAIRPATEADLPTIVGIYAHHVRTGTASFEIDAPDLAEMTRR
FHALRDAGMPYVVAEAGGVLLGYAYAGPHRARPAYRHTVEDSIYLDATAQGRGVGTLLLE
ALIRECQTRGFKQMVAVVGGGRENPGSAKLHARCGFREVGVLEAVGYKFGRWLDCLLMQR
AL