Protein Info for ABZR87_RS21910 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 367 (338 residues), 140 bits, see alignment E=4.6e-45 amino acids 238 to 409 (172 residues), 58.6 bits, see alignment E=2.7e-20

Best Hits

KEGG orthology group: K08223, MFS transporter, FSR family, fosmidomycin resistance protein (inferred from 93% identity to rpf:Rpic12D_3640)

Predicted SEED Role

"Fosmidomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>ABZR87_RS21910 MFS transporter (Ralstonia sp. UNC404CL21Col)
MQTTANGTAAASATPAAQADKTGFGVIGAISFAHFLNDMMQSLILAIYPLLKGNFHLDFS
QIGLITLTYQITASLLQPMVGLYTDKHPKPYSLAVGMGFTLVGLLLLSVAPNFGTVLLAA
ALVGTGSSIFHPESSRVARMASGGRHGLAQSLFQVGGNVGSAMGPLLAAIIIMPYGQHSL
AWFSIAALIAIFVLYHVGGWYKRERAAGHARKAGGRAHAAVKLSGGQVAFAMTLLVVLLF
SKYFYLASLNSYYTFFLITKFHLSAQTSQLFLFLFLFSVAVGTIVGGPIGDRVGRKVVIW
VSILGVAPFTLLLPYANLFWTAVLTVIIGLVLASAFSAILVYAQELIPGKVGMVSGLFFG
FAFGLGGIGAAVLGKLADATDIYNVYHLCSFLPLIGLLTVFLPDIERKRQQAA