Protein Info for ABZR87_RS21885 in Ralstonia sp. UNC404CL21Col

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF00106: adh_short" amino acids 11 to 205 (195 residues), 179.7 bits, see alignment E=9.2e-57 PF01370: Epimerase" amino acids 13 to 180 (168 residues), 21.2 bits, see alignment E=3.4e-08 PF08659: KR" amino acids 14 to 163 (150 residues), 37.3 bits, see alignment E=5.6e-13 PF13561: adh_short_C2" amino acids 17 to 253 (237 residues), 219 bits, see alignment E=1.4e-68

Best Hits

Swiss-Prot: 40% identical to DHRS4_RABIT: Dehydrogenase/reductase SDR family member 4 (Fragment) (DHRS4) from Oryctolagus cuniculus

KEGG orthology group: None (inferred from 91% identity to rpi:Rpic_4714)

MetaCyc: 40% identical to 4-oxopentanoyl-CoA 4-dehydrogenase (Pseudomonas putida KT2440)
1.1.1.M44 [EC: 1.1.1.M44]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>ABZR87_RS21885 SDR family oxidoreductase (Ralstonia sp. UNC404CL21Col)
MSTNLFDLTGKIALVTGASRGIGEEIAKLLAEQGAHVIVSSRKLADCEIVAEHIRAAGGK
AEALACHVGRMEDIAAAFDTIRRTHGRLDILINNAAANPHFGHILDTDLAAYEKTVEVNI
RGYFFMSVEAGKMMKAQGGGAIVNTASVNALHPGDKQGIYSITKAAVAHMTRAFAKECGP
FGIRVNALLPGLTKTRFAGALFEDKATYDRWISEIPLRRHAEPREMAGTVLYLVSDAASY
TNGECIVVDGGMTV