Protein Info for ABZR87_RS21875 in Ralstonia sp. UNC404CL21Col

Annotation: M20/M25/M40 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04389: Peptidase_M28" amino acids 89 to 206 (118 residues), 47.1 bits, see alignment E=5e-16 PF01546: Peptidase_M20" amino acids 103 to 401 (299 residues), 115 bits, see alignment E=9.2e-37 PF07687: M20_dimer" amino acids 207 to 305 (99 residues), 83.3 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 38% identical to CBPG_PSES6: Carboxypeptidase G2 (cpg2) from Pseudomonas sp. (strain RS-16)

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 91% identity to rso:RS03691)

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.11

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>ABZR87_RS21875 M20/M25/M40 family metallo-hydrolase (Ralstonia sp. UNC404CL21Col)
MKPSRLAVAALLLCVSGLSCAADANPKVLSAAEGYRGDALQLLERLVNIDSGTGNEAGLS
QIGTIVTDELRKAGAQVETVSAAPAVGNNILATWKGTGKTRILLMAHMDTVFKDGTARAK
PFTIKDKRAYGPGVMDDKGGVVAGLYAMKILQQLDFKQYGQVTLLLNTNEETGSKGTRAL
IEREAKQHDVTLNLEPGRPADGLVVWRKGSGTAEVDVKGKAAHAGVAPESGRNAANELAH
QVLQLGKLGDSAKQTTFNVTVLKAGDATNVIPDHATAYADVRVAVPEEFDRVERDLTRVS
ANKLIPDTEVKTSLVRSFPPMPRNAASDQLAARAQAIYGEIGRKLTLEGSGGAADSSLSA
GVGTPTLDGFGIVGGGIHTPEEYAEVESVVPRLYLLSRMIMELAANK