Protein Info for ABZR87_RS21765 in Ralstonia sp. UNC404CL21Col

Annotation: family 2A encapsulin nanocompartment cargo protein cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01979: cysteine desulfurase, SufS family
  • amino acids 225 to 617 (393 residues), 561.3 bits, E=5.6e-173
• PF00266: Aminotran_5
  • amino acids 243 to 612 (370 residues), 495.1 bits, E=2.5e-152
• PF00155: Aminotran_1_2
  • amino acids 287 to 470 (184 residues), 45.2 bits, E=1.5e-15
• PF01041: DegT_DnrJ_EryC1
  • amino acids 293 to 424 (132 residues), 24.1 bits, E=4e-09
• PF01212: Beta_elim_lyase
  • amino acids 305 to 462 (158 residues), 30.4 bits, E=5.1e-11

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• molybdopterin biosynthesis (3/6 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (3/10 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (3/11 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Protein Sequence (622 amino acids)

>ABZR87_RS21765 family 2A encapsulin nanocompartment cargo protein cysteine desulfurase (Ralstonia sp. UNC404CL21Col)
MTTPTPTSNAPGVSGLAPPAGLPDPAALAQLANAFFTALPGREPEPEPAPAIDLTPVGAS
PQLSALPVAETAPSAPQVPVLGVPTQYAAALPQAASGHGLPGPAHSVSAPSSPYYFLGEA
SGYQSAAPHAGVAASEVGVPEDRVSAQPFQLPGTDALARLIDGASGTPPAGPEALRQPGG
AAQAGQFYFLAPAGGPAAPALEAPRNTRDEQSHQPHRVGAFDVHAVRRDFPILAERVNGR
PLIWLDNAATTHKPQAVIDRLAYFYAHENSNIHRAAHELAARATDAYEGARNKVARFLGA
RSASEIIFVRGATEAINLVAQTFGRQHIGAGDEIIVSHLEHHANIVPWQQLAAQVGARIR
VIPVDDSGQVLLDEYRKLLSSRTKLVSVTQVSNALGTVTPVQEIIALAHAAGARVLVDGA
QAVSHLRVNVQALDADFYVFSGHKVFGPTGIGVVYGKQDLLDTLPPWQGGGNMIADVTFE
KTLYQPAPARFEAGTGNIADAVGLGAALDYVERIGLEHIARYEHDLLVYATHGLSRIPGV
RLIGTAANKASVLSFTLAGYRTEEVGAALNREGIAVRSGHHCAQPILRRFGVEATVRPSL
AFYNTCEEVDELVRVVGALARR