Protein Info for ABZR87_RS21630 in Ralstonia sp. UNC404CL21Col

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 184 (26 residues), see Phobius details PF21088: MS_channel_1st" amino acids 137 to 178 (42 residues), 34.3 bits, see alignment 2.8e-12 PF00924: MS_channel_2nd" amino acids 180 to 246 (67 residues), 68 bits, see alignment E=9.7e-23 PF21082: MS_channel_3rd" amino acids 252 to 331 (80 residues), 38.7 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to rpi:Rpic_4689)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>ABZR87_RS21630 mechanosensitive ion channel family protein (Ralstonia sp. UNC404CL21Col)
MEWLNAHTFLRVPARDWAAATLTVIAAYAVLSSVLRLICNRLDARARRTGHRFDILVTAV
LRDTHPLFIALAALLAGSYFIDLPTRIANKLDHIWFVIIGFQIALWLNRGVKLWARDRLS
TQTHATRNPVITSMTAWVLRFALWSMLLLAILANVGVNITAFVASLGVGGVAVALAVQSI
LSDLFASLAIGLDKPFEIGDFIVFESIAGTVQNVGLKTTRIRSLSGEEIIASNTALLKST
IHNYKRMSERRIVFTFGVTYDARAAQLQKIPDIVRHAVEAAGNTRFDRAHFKEFGENALN
FEVVYFVTDPDFNLYMDIQQRINLTILEGLENLGTSFALPTRTIQLVRRDGEPVQPEELA
DRKSTANAQRVSARASG