Protein Info for ABZR87_RS21595 in Ralstonia sp. UNC404CL21Col

Annotation: Rrf2 family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02082: Rrf2" amino acids 4 to 132 (129 residues), 109.1 bits, see alignment E=9.6e-36

Best Hits

Swiss-Prot: 38% identical to YWNA_BACSU: Putative HTH-type transcriptional regulator YwnA (ywnA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 89% identity to rsl:RPSI07_mp0456)

Predicted SEED Role

"Rrf2 family transcriptional regulator, group III" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>ABZR87_RS21595 Rrf2 family transcriptional regulator (Ralstonia sp. UNC404CL21Col)
MSTSSRFAVAVHILTLLASAEGPVPSSLIAGSVGTNPALIRRLVAQLADAGFVTSQMGAT
GGATLARPADRITLLDVFRVVESPVLIALPPNAPNPACEVGREITGVLERVTERAQAALE
AELAAQTIAGILSEVGHAQRRRRRA