Protein Info for ABZR87_RS21570 in Ralstonia sp. UNC404CL21Col

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF01494: FAD_binding_3" amino acids 18 to 49 (32 residues), 22 bits, see alignment (E = 3.5e-08) PF00890: FAD_binding_2" amino acids 19 to 224 (206 residues), 32.7 bits, see alignment E=2e-11 PF01266: DAO" amino acids 19 to 412 (394 residues), 262.5 bits, see alignment E=3.2e-81 PF13450: NAD_binding_8" amino acids 22 to 52 (31 residues), 27.3 bits, see alignment (E = 1.4e-09)

Best Hits

KEGG orthology group: None (inferred from 83% identity to aav:Aave_2806)

Predicted SEED Role

"Small molecule metabolism; Degradation; amino acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>ABZR87_RS21570 FAD-binding oxidoreductase (Ralstonia sp. UNC404CL21Col)
MSQPLRLIESASPLPAQADVVVIGGGIIGVFAAYYLARRGVSVAVVEKGRIGAEQSSRNW
GWCRQQNRDARELPMATKSLELWEQFAADTGEDTGFRRCGLLYLSNDEEELARWTKWRDF
AKTAGVTTHMLSSTEASERGRLTGRAWKGGVFSPSDGTADPAKAAPSVAAALMKLGGTVH
QNCAARGIEIEGGRVSGVVTEAGTIKTRTVVFAGGAWASSFCRQLGIRFPQATVRQSIVR
VTGVTEPVPDALHTARVSITRRSDGSYNLAISGRGRVDPTAQLLRFAPQFLPMFAKRWRN
VFPGGLEGIRAGHETLARWRLDAPTPMERMRILDPRPDAAAVKQTYSRAVELLPVLGQAG
IANAWAGFVDNTPDGVPGIGEVPEIPGFILAAGFSGHGFGIGPGAGHLIADLVTGEKPIF
DPAPYDPARFKHSAWGKVADF