Protein Info for ABZR87_RS21435 in Ralstonia sp. UNC404CL21Col

Annotation: TIGR03862 family flavoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 10 to 183 (174 residues), 28.9 bits, see alignment E=3.5e-10 PF03486: HI0933_like" amino acids 10 to 409 (400 residues), 403.9 bits, see alignment E=3.3e-124 PF01494: FAD_binding_3" amino acids 10 to 41 (32 residues), 27.7 bits, see alignment (E = 7.2e-10) TIGR00275: flavoprotein, HI0933 family" amino acids 10 to 409 (400 residues), 299.4 bits, see alignment E=3.8e-93 PF13454: NAD_binding_9" amino acids 11 to 172 (162 residues), 23 bits, see alignment E=3e-08 PF13450: NAD_binding_8" amino acids 12 to 43 (32 residues), 26.8 bits, see alignment (E = 2.3e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 30 to 415 (386 residues), 546.4 bits, see alignment E=2.9e-168

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 88% identity to rpi:Rpic_4677)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>ABZR87_RS21435 TIGR03862 family flavoprotein (Ralstonia sp. UNC404CL21Col)
MSETSNAPLVAVIGAGPAGLMAAEVLSRNGVRVEVFDAMPSAGRKFLLAGIGGMNITHSE
PIDAFLGRYRTRREALAPFIGRFGPDDLRAWIHVLGIDTFVGSSGRVFPTEMKAAPLLRA
WLHRLREAGVQLHMRHRWVGWAEPSDHAQVLRFETADVERLVQADAVVLAMGGGSWPRLG
SDGAWVPLLEARGVQVQPLQPANCGFDADWSAYFQERFAGQPVKSVAIGLPSGDGGALQF
RQGEFVVTQTGIEGSLVYALSAPIRDALATEGSATIWLDLAPGWSAQRVTDELMRPRGAR
SMSSHLQSKLNITGVKLGLLRECLSKEAFADLAQLAKAIKALPLRLIRTRPIDEAISTAG
GVVFEALDAKLMIERLPGVFCAGEMLDWEAPTGGYLLTACFASGAAAGQGALDYLAAMAC