Protein Info for ABZR87_RS21265 in Ralstonia sp. UNC404CL21Col

Annotation: DHA2 family efflux MFS transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 232 to 249 (18 residues), see Phobius details amino acids 269 to 292 (24 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details amino acids 397 to 422 (26 residues), see Phobius details amino acids 442 to 464 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 13 to 424 (412 residues), 257.7 bits, see alignment E=1.1e-80 PF07690: MFS_1" amino acids 17 to 412 (396 residues), 163.4 bits, see alignment E=3.6e-52

Best Hits

KEGG orthology group: None (inferred from 89% identity to rpf:Rpic12D_3496)

Predicted SEED Role

"MFS family multidrug efflux protein in Burkholderiaceae, unknown substrate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>ABZR87_RS21265 DHA2 family efflux MFS transporter permease subunit (Ralstonia sp. UNC404CL21Col)
MTHGIDERKRWLALIVLCLGVLMIVLDTTIVNVALPSIQADLGFTETSLVWVVNAYMLTF
GGCLLLGGRLGDLFGHRKLFLLGLTLFTLASAACGLANSQGLLITARAVQGLGGAVVSAV
SLSLIMNLFTSPADRAKAMGIYGFVCAGGGSIGVLLGGLLTSTLSWHWIFLVNLPIGVAV
YAACVALLPVGKPLADRTKLDVAGAIAVTASLMLAVYAVVHGNEAGWTSTQTLTQLGIAI
ALMIAFLVIESRVSHPLMPLHMFALRNVATANVVGVLWAAAMFAWFFISALYMQRVLDYS
AMQVGLAFLPANIIMAVFSLGLSAKLVMRFGIRAPLSVGLLVAGIGLVLFARAPAGGSFV
LDVLPGMLLLGLGAGVAFNPVLLAAMSDVAPDESGLASGVVNTSFMMGGALGLAILASLA
AARTEGLAAAGADATTALNGGYHLAFLLGAVAAVLGSVLAGVFVRTRTQGAGQGEASSAA
PI