Protein Info for ABZR87_RS21150 in Ralstonia sp. UNC404CL21Col

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 133 to 158 (26 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 222 to 247 (26 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 258 (251 residues), 94.8 bits, see alignment E=2.5e-31

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 89% identity to vpe:Varpa_3478)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABZR87_RS21150 branched-chain amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MAFFAEVLVGGLLSGVMYSLVAIGFVLIYKTSGVLNFAQGAQLLFAALTFVSLLERGVPF
PLALLLTFTLMVLLGLGIERAVLRPLVNQPPITLFMATLGLSYVIEGVAQLVWGTQVHEL
NLGISDAPLQIGGILVSSFDLFAAATAAVMVTALSVFFRYTRVGLAFRAVADDTFAAIAV
GLRLPRIWATVWATAGVIALVAGLLWGARLGVQFSLSLVVLKALPVLVLGGFDSILGAVV
GGLIIGALEKLAEVYLGPFVGGGIESWIAYVAALAFLLVKPGGLFGLRPVERA