Protein Info for ABZR87_RS21010 in Ralstonia sp. UNC404CL21Col

Annotation: carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00484: Pro_CA" amino acids 34 to 189 (156 residues), 162.7 bits, see alignment E=4.2e-52

Best Hits

Swiss-Prot: 79% identical to CYNT_PSEAE: Carbonic anhydrase (cynT) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 91% identity to bvi:Bcep1808_5914)

MetaCyc: 69% identical to carbonic anhydrase 1 (Escherichia coli K-12 substr. MG1655)
Carbonate dehydratase. [EC: 4.2.1.1]

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>ABZR87_RS21010 carbonic anhydrase (Ralstonia sp. UNC404CL21Col)
MRDIIDGFLRFQRDIYPQRVELFKQLATSQNPKALFVTCSDSRVVPELLTQREPGELFVI
RNAGNIVPSYGPEPGGVSATVEYAVAVLGVQDIVICGHSDCGAMGAISRCTCLDHLPAVA
NWLRHSDAAKVINAAHTFDSPRAKLDGLVRENVIAQLANLRTHPSVALALEQGRMNLHGW
VYDIERGSIDALDGATRRFVPLAESPTTVAVTSRSQRQG