Protein Info for ABZR87_RS20960 in Ralstonia sp. UNC404CL21Col

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details amino acids 489 to 512 (24 residues), see Phobius details PF06609: TRI12" amino acids 26 to 442 (417 residues), 37.7 bits, see alignment E=1.4e-13 PF07690: MFS_1" amino acids 27 to 422 (396 residues), 175.8 bits, see alignment E=1.8e-55 PF00083: Sugar_tr" amino acids 57 to 194 (138 residues), 28.2 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to rpi:Rpic_4552)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>ABZR87_RS20960 MFS transporter (Ralstonia sp. UNC404CL21Col)
MAVHTALPHSHTQVLPFKESLLAMIGICFVVVLVAFDQTVVGTALPTVVAELKGFELYAW
VATSYLLTSVVTVPIFGRLGDFYGRKPFVIASIVVFTLASVMCGMAGSMTFLVWSRALQG
IGGGMLVGTAYACIPDLFPDARVRLRWQVMLSASFGIANAIGPTLGGWMTQAFGWRSVFY
VNIPFGVLGLWFAWRFLPHLRQNVHTGRIRLDWQGAVLITVALGALQLFVEWLPRHGLTL
ALFGWLVLSAAAFVALWWWEQRAEQPLLPFDMLRNPALATLFMLALLSGFSMFAVLFYAP
LLFQGGFGMSPQEAGLVITPLVVCITLGSIINGRIVTRIPKPNAMLYAGFALLTVAVAGM
SVSSRGMPHAVLTLLMLLAGLGLGFVLPNLTVFAQQTAGRAHLGIATALLQSLRMVGGMV
GTALVGTLVSERYASGVANALRADSATEWLHQLADPEILIDHDAQAALLSQLHAAGHDGA
ALLEAARHVLVGAIHIGLIVATVVALIGLWYVRRVPPVVLHHVEPVQHTE