Protein Info for ABZR87_RS20915 in Ralstonia sp. UNC404CL21Col

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 25 to 493 (469 residues), 386.8 bits, see alignment E=7e-120 PF02321: OEP" amino acids 81 to 281 (201 residues), 93.7 bits, see alignment E=6.1e-31 amino acids 310 to 492 (183 residues), 127.4 bits, see alignment E=2.7e-41

Best Hits

KEGG orthology group: None (inferred from 83% identity to rpf:Rpic12D_3473)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>ABZR87_RS20915 efflux transporter outer membrane subunit (Ralstonia sp. UNC404CL21Col)
MKTGRTGRLAGSYAPGGRARIAALVLALLLAGCAVGPDYHTPPLSGTEAPQGWHATLPHH
GSRMALARWWEQFQDPVLTQLVEQADATSPTIAQAVGRVREARASVSTSRAALVPQLKGS
GSAMRQGGFGGSQFAGGAGGLYGGALNPTLGLGTITTLAAQADASWEIDLFGGKRRSLEG
ADARLTASEADWHDARVSLAAEVANAYLQQRECEALVNIGAATLSSRQETLQLTERKFRA
GFVAPADFAQAQATVGDAVNALEGQRAQCAQGIDKLVTLTGLDHDALNGLLSKDNAQIPA
QPDAGVPDVPAQVLSQRPDVSSAERAVAGASADIGVAVASRLPSITLAGSIGINSYRLGG
QSLTSKSWSFGPSVSLPIFDGGSGAARVETARARYDQALASYRGKVRQAVQEVEDALVRL
DASDRRVDAAAMADAQYAKVLEASNARYRLGAGSLLQLEDVRRTALQASQSLAAVKLERA
QAWVALYKAVGGGWRDDGANPHPENKTTAPAAQGGAHTGTAS