Protein Info for ABZR87_RS20210 in Ralstonia sp. UNC404CL21Col

Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 907 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 12 to 895 (884 residues), 1280.8 bits, see alignment E=0 PF02861: Clp_N" amino acids 23 to 75 (53 residues), 36.4 bits, see alignment 2.1e-12 PF00004: AAA" amino acids 232 to 345 (114 residues), 37.8 bits, see alignment E=1.1e-12 amino acids 642 to 760 (119 residues), 30.2 bits, see alignment E=2.6e-10 PF17871: AAA_lid_9" amino acids 374 to 474 (101 residues), 100.3 bits, see alignment E=2.4e-32 PF07724: AAA_2" amino acids 637 to 805 (169 residues), 192 bits, see alignment E=3.6e-60 PF07728: AAA_5" amino acids 642 to 761 (120 residues), 37.1 bits, see alignment E=1.4e-12 PF10431: ClpB_D2-small" amino acids 812 to 887 (76 residues), 36.5 bits, see alignment E=1.9e-12

Best Hits

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (907 amino acids)

>ABZR87_RS20210 type VI secretion system ATPase TssH (Ralstonia sp. UNC404CL21Col)
MAIPLKTLIAKLNATSRQAAERAASLCMARGNYEVDLEHLFLALLENRRSDFAVAARASG
IDLVALQRDLEAEIGRFQTGNTRTPAFSPYLPKLFEHGWLIASLDSQITRIRSGHLLLAL
LTEPSLSALAQRGSRLFGQIEADRLKHDFDRLTAGSDEQEQAVDIADDGADATQGEGGKP
AAALTSTPALDQFTVDLTQSARDGRIDPVIGRDAEIRQVIDILMRRRQNNPILTGEAGVG
KTAVVEGLALRVAANDVPPPLQGVTLRTLDMGLLQAGASVKGEFENRLKNVIDEVKKSPK
PIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALAR
RFQVVKVEEPSEPLAAAMLRGMAGLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAV
SVLDTACAKVALGQSATPGAIEDDQKTLERLQGEINALEREQSAGAEHDARLKALNEQRT
ELEQRVAQNTERLAQERALVARIQALREARESGTAQAGEEDALPVAANSDVVSIPKRKRA
ADKADEQDELATLLAELRALQGESPMVPLQVDGHVVSEIVSAWTGIPLGRMVKDELRTVL
NLKPLLAARVIGQDHALDAIAQRVRTATANLEDPNKPRGVFLFAGPSGVGKTETALALAD
ILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVE
KAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSQAIMQACLNKPAEELPDT
DALAELLRPTLYKAFKPAFLGRMKVVPYYPISDDVLAEIITLKLGRIRDRVAINHKATFQ
WDNALVESVLARCTEVDAGARAVDHILNGTLLPQIAESVLTRMAEGGSVEKIKVGVGKNG
EFKYRIN