Protein Info for ABZR87_RS19915 in Ralstonia sp. UNC404CL21Col

Annotation: acetate/propionate family kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 310 to 329 (20 residues), see Phobius details TIGR00016: acetate kinase" amino acids 4 to 389 (386 residues), 357.9 bits, see alignment E=3e-111 PF00871: Acetate_kinase" amino acids 5 to 385 (381 residues), 361.9 bits, see alignment E=1.7e-112

Best Hits

KEGG orthology group: K00925, acetate kinase [EC: 2.7.2.1] (inferred from 93% identity to rpi:Rpic_4317)

Predicted SEED Role

"Acetate kinase (EC 2.7.2.1)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.7.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (393 amino acids)

>ABZR87_RS19915 acetate/propionate family kinase (Ralstonia sp. UNC404CL21Col)
MNDCIVVLNCGSSSIKFALFDATLDPLPRVPMWNGKVEGIGTAHPTATEAGAPTQAVELD
AAQPYHAALVHIRRRVEQRLDGRRLMAVAHRVVHGGAKYFAPVCVDAEVLSDLRTYIPLA
PLHQPFALEAIEALLSDLPDVPQVACFDTAFHRTLPQVETMLPLPYSAWERGLRRYGFHG
LSYEYMSIALPERHGDIARGRTIVAHLGSGASLCAMHELKSVATTMGFSALEGLMMGTRC
GSLDPGAVLYMMETEHLSPAQVGHVLYHESGLLGVSGLSSDPRELISHEADHPRAQAALA
LYVRRIVREIGALVAVLGGLDFLVFTAGIGEHNAVLRERVVGALGYLGAELDEAANQAHA
AIISSSASRVRVAVEPTNEEWVAARHAVRCKLQ