Protein Info for ABZR87_RS19680 in Ralstonia sp. UNC404CL21Col

Annotation: potassium transporter Kup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 294 to 324 (31 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 402 to 422 (21 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details PF02705: K_trans" amino acids 19 to 470 (452 residues), 613.3 bits, see alignment E=2.3e-188 PF22776: K_trans_C" amino acids 483 to 631 (149 residues), 153.4 bits, see alignment E=4.3e-49

Best Hits

Swiss-Prot: 90% identical to KUP1_RALSO: Probable potassium transport system protein kup 1 (kup1) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03549, KUP system potassium uptake protein (inferred from 98% identity to rpf:Rpic12D_4387)

MetaCyc: 51% identical to K+:H+ symporter Kup (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-3

Predicted SEED Role

"Kup system potassium uptake protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (631 amino acids)

>ABZR87_RS19680 potassium transporter Kup (Ralstonia sp. UNC404CL21Col)
MTTAAASHTKKNPALMATMVGAIGVVFGDIGTSPLYALKECFNPEHGVPFSDQTVFGILS
MLFWAMTLVVSVKYVLFVMRADNNGEGGILALTALAMRASSGSARFTRTLMLLGLLGAAM
FYGDAVITPAISVLSAIEGMEIMAPALQTWVLPLALIVLIALFLIQKQGTHVVGRLFGPI
MVIWFVLLGLIGLASVVKSPQILVALSPLYAIEFGFRHTVLAFIVFGSVFLALTGAEALY
ADMGHFGARPIRYAWFYIAMPCLLLNYFGQGALLLREPSAVQNPFFLLMPNWAVGPMVVL
ATAATVIASQAVISGAFSMTAQAVHLGYAPRMKILYTSDVEIGQIYVPVVNYMLLVLVVA
VVLAFGKSDNLAAAYGIAVTTTMVLTTGLVTVVMRNAWKWRLSLVACIGAVFLAVDLSFF
SANLLKIAAGGWFPLLLGGLIFFLMVTWHTGTQLLKARNVEGGIPLEPFMEGLLRHPPYR
VDGTAVYLTPSIEFVPLALLHNLKHNHVLHKRVLFIHFRTLAVPYVDPAKRLVIKTIGDD
IHTAVVDFGFKETPAVDEIVRSVGERLGIVFEDMETSFFITRATVVPSPLPGMAMWRESL
FAWMQHNSAKPSDFFRIPANRLVELGSKVEI