Protein Info for ABZR87_RS18965 in Ralstonia sp. UNC404CL21Col

Annotation: cardiolipin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 27 (4 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details TIGR04265: cardiolipin synthase" amino acids 7 to 477 (471 residues), 364.5 bits, see alignment E=4.8e-113 PF13091: PLDc_2" amino acids 135 to 242 (108 residues), 28.6 bits, see alignment E=1.1e-10 amino acids 319 to 443 (125 residues), 106.2 bits, see alignment E=1.2e-34 PF00614: PLDc" amino acids 217 to 243 (27 residues), 29.2 bits, see alignment (E = 6.8e-11) amino acids 391 to 417 (27 residues), 32 bits, see alignment (E = 8.8e-12)

Best Hits

KEGG orthology group: K06131, cardiolipin synthase [EC: 2.7.8.-] (inferred from 98% identity to rpf:Rpic12D_4283)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>ABZR87_RS18965 cardiolipin synthase (Ralstonia sp. UNC404CL21Col)
MLTNTTAFAAFLFLVHCVGVLAAMHAVLTVRTSQGAIAWAISLVTLPEFTLIPYLIFGRS
TFAGYVDARRFHNARLREITLSDDWRRLRDHESSVVAPQHTCMQALPRLTGTPCLARNRV
RLLVNGAETFDAIFAAIAQARRVLIVQFFIVHDDTLGRRLAELLLDRARAGVRVYFLFDS
IGCHALPRHYVHRLVEGGVHAKPFSTHAGFVNRFQLNFRNHRKLVVVDGERAYVGGHNVG
NEYMGEKPPLAPWRDTHIEIVGAAVMDLQLTFAEDWYWAAREVPQLIVPELRPEEDMVCQ
VVASGPADKQETCSLFFMEAIQSARKRLWITSPYFIPDEAVFAALRLAVLRGVDVRILIP
SRPDHHMVFLASSLYAYQAIRAGVKIYRYLPGFLHQKVVLIDDEAAAVGSANLDNRSFRL
NFELMIMTADSRFANDVAQMLEADFAEAARVGRDEYEHAHPLRRVIMHVAKLFAPIL