Protein Info for ABZR87_RS18915 in Ralstonia sp. UNC404CL21Col

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 52 to 75 (24 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 323 to 348 (26 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 19 to 420 (402 residues), 247.8 bits, see alignment E=9.1e-78 PF01554: MatE" amino acids 19 to 179 (161 residues), 117.7 bits, see alignment E=2.1e-38 amino acids 248 to 409 (162 residues), 92.5 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 44% identical to YOEA_BACSU: Probable multidrug resistance protein YoeA (yoeA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to rpi:Rpic_4169)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>ABZR87_RS18915 MATE family efflux transporter (Ralstonia sp. UNC404CL21Col)
MTAPAARPLWRTFIAFLGPLILANILQSLSGTLNNVYVGHMLGVKALAAVSAFFPILFFF
IAFIIGLGSGAAVLIGQAWGAKKPEAVKTVAGTTLSVGFIVGLAVALLGGPFANALLGWL
GTPADILQDATLYASVMLYAMPGLFVYLLATAMMRGVGDTRTPLRTLALSTAIGLVLTPT
FIRGWFGLPQLGVASGAAATIISFTVALVWLAFFLRRRNHPLAPDAVLARHLWVDLGVLQ
TVLRIGVPTGVQLVVISIAELALLSFVNGFGSDATAAYGAGTQIISYVQFPAMSIAITAS
ILGAQAIGSGNTERLDAITRTGLWLNVAITGVLVLMAMLFSRAVIGWFTTNTEVMSLAQS
LLHISLWSSVIFGMASVFSGVMRSSGTVMAPTAISILAIAAVEVPVAWVLSRHIGTDGIW
AAYPAAFLAMFVMQGLYYALVWRRRAQRFGIRRMV