Protein Info for ABZR87_RS18900 in Ralstonia sp. UNC404CL21Col

Annotation: type VI secretion system tip protein TssI/VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 TIGR01646: Rhs element Vgr protein" amino acids 2 to 207 (206 residues), 207.7 bits, see alignment E=3.7e-65 TIGR03361: type VI secretion system Vgr family protein" amino acids 2 to 205 (204 residues), 234.4 bits, see alignment E=2.3e-73 PF04717: Phage_base_V" amino acids 96 to 155 (60 residues), 38.8 bits, see alignment 1.5e-13 PF13296: T6SS_Vgr" amino acids 180 to 287 (108 residues), 123.4 bits, see alignment E=6.4e-40 PF10106: DUF2345" amino acids 320 to 464 (145 residues), 132.6 bits, see alignment E=1.7e-42

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>ABZR87_RS18900 type VI secretion system tip protein TssI/VgrG (Ralstonia sp. UNC404CL21Col)
MRGVAAGCTYQIANHDKDDLNREFLVVSTELELEDVAVQSGSIQRYACHVRFEAHPTDEV
FRPPLTTAKPRVKGIQRAVVTGPENQEVWTNDFGCVKVQFEWDRYGQYDQNSSPWIRVAN
GWSGDQFGAMHIPRIGQEVLVDYLNGDPNTPIIIGRVPNQLNLPPWQLPGQHALSGIASK
ELFGKRRNHLLMDDTQGQIQAQLSSDHQTSQLNLGYLTGVPGNPGRKDQRGEGFDLRTDG
QGAIRGAKGLLLTTEGQIAAVGGHLDRQEFIRCMEAALEAAKSLGEYSSQHEALKTDAGP
QSTLTKAIEEWDAGANNHQDKPGRGGQPLLGAYAPAGIGLATPKSLTSYAGQHIDTVSKL
NQQQTAGQQYLVNAGTGISLFAHSGEWKGIAHQGQLVLQAQQKSITSNAKQDVVVTATDG
TIVLNAKTGITLMSGNAGIRIAGGKVEAFGPTLIHLHTGNFDVPPAQGIDGALPQFDSGD
TKRSFALVREIDGEPISSTAYTLTTADGSVVGNGVAADGVTPESTLQQIEHLQAAFKLPK
LF