Protein Info for ABZR87_RS18850 in Ralstonia sp. UNC404CL21Col

Annotation: PAS domain-containing methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 167 to 187 (21 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details PF13426: PAS_9" amino acids 19 to 106 (88 residues), 40.7 bits, see alignment E=6.1e-14 PF00989: PAS" amino acids 20 to 107 (88 residues), 37.3 bits, see alignment E=6.1e-13 TIGR00229: PAS domain S-box protein" amino acids 20 to 113 (94 residues), 45.2 bits, see alignment E=4.8e-16 PF08448: PAS_4" amino acids 24 to 113 (90 residues), 29.8 bits, see alignment E=1.5e-10 PF08447: PAS_3" amino acids 31 to 113 (83 residues), 63.4 bits, see alignment E=4.9e-21 PF00015: MCPsignal" amino acids 327 to 482 (156 residues), 182.2 bits, see alignment E=2e-57

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 83% identity to rsl:RPSI07_mp1250)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>ABZR87_RS18850 PAS domain-containing methyl-accepting chemotaxis protein (Ralstonia sp. UNC404CL21Col)
MRVNEPVTQREYEFPDNATLMSTTDTQSYIAYANAAFVEVSGFSREEIEGKPHNIVRHPD
MPPEAFADMWATLKAGQPWTALVKNRRKNGDHYWVRANATPVVRNGRTSGYMSVRTKPTR
EEIAGAEALYKDFRTGQAGSRKFHKGLIVRTGLMAWRSGFQVMPVRWRIRLTFLTLLPAL
VALAWGFGMSGAALGGFAGALLVALALASWSLKVQIATPLEKLQELALSVASGESRKVAI
ADRVDEIGMTLRTISQLGLMFRWLIDDVAEQVVNVQSASQEIAKGNGDINIRTEQAAASL
EETSSSMTQMTATVASNAETAGQANTLSGEATQAAVNGGRAMEQVVATMSAISQSAKQIA
DIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRALAQRSAGAAKEIKELIG
TSVDKVESGSRLVDDAGKTMDDIVEQVKKVSAMIADISLATAQQTEGITQVSQAVNHLDQ
VTQENATLVGQSAAAAEGLRIQATRLVEAVNVFR