Protein Info for ABZR87_RS18690 in Ralstonia sp. UNC404CL21Col

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01547: SBP_bac_1
  • amino acids 5 to 290 (286 residues), 188.8 bits, E=2.5e-59
• PF13416: SBP_bac_8
  • amino acids 7 to 321 (315 residues), 106.7 bits, E=1.9e-34

Best Hits

KEGG orthology group: K10227, sorbitol/mannitol transport system substrate-binding protein (inferred from 71% identity to hse:Hsero_0440)

MetaCyc: 59% identical to polyol ABC-type transporter periplasmic substrate-binding protein (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, periplasmic substrate-binding protein" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Protein Sequence (401 amino acids)

>ABZR87_RS18690 sugar ABC transporter substrate-binding protein (Ralstonia sp. UNC404CL21Col)
MIVLQKLSSQFEQAHPDIKLRWVTLEEGVLRQRVTTDIATGSGQFDLMTIGGYEAPLWAK
KGWLTPLDMPASYDAADLLPTVRDGLSQGGKLFAVPFYAESSMTYYRRDLFSAAGLKMPE
QPTYDDIAQFAAKLHDPAKGVYGICVRGRAGWGENMALVSTMVNTFGGRWFDEKWQPTID
TPQWKQAVNTYVDLLKKYGPPGASSNGFNENLVLFSGGKCGMWIDATVAAGMVSSAKDSK
VADKVGFANAPIASTPKGSHWLWIWALAVPKSSKSPEAAKTFAAWATSKDYIRAVAKAQG
WGEVPPGTRASTYDDPAYQKAAPFSGFVRHAIETANPNDPSAQKVPYTGVQFVTIPEFQS
LGTVVGQAIAGALTGKTTVDDALRVSQSQAQRAMRQGGYLK