Protein Info for ABZR87_RS18680 in Ralstonia sp. UNC404CL21Col

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 73 to 94 (22 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 261 (175 residues), 60.7 bits, see alignment E=8.1e-21

Best Hits

KEGG orthology group: K10229, sorbitol/mannitol transport system permease protein (inferred from 76% identity to hse:Hsero_0442)

MetaCyc: 64% identical to polyol ABC-type transporter permease component MtlG (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, permease component 2" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>ABZR87_RS18680 carbohydrate ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MSTLTSTWRTRLAGVLAWAIALALFFPIAWAALTAFKTEQDAYTPTLLFTPTLDSFREVL
ERAHYPSFLGNSLAVSIISTLLALAIAIPAGYAMAFFPNKRTQQVLLWMLSTKMMPAVGV
LLPVYLLAKTAGLLDSITALVIVYTLANLPIAVWMVFTYCNDVPREILEAARMDGANLWQ
ELVYVLLPTMLPGLASTALLLLILSWNEAFWSLNLTSIDAAPLTVFIASYSNPEGLFWAK
LSAASVLAIAPILVLGWLAQRQLVRGLTFGAVK