Protein Info for ABZR87_RS18330 in Ralstonia sp. UNC404CL21Col

Annotation: fumarate reductase/succinate dehydrogenase flavoprotein subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 PF00890: FAD_binding_2" amino acids 9 to 378 (370 residues), 106.4 bits, see alignment E=3.2e-34 PF02910: Succ_DH_flav_C" amino acids 441 to 544 (104 residues), 57.3 bits, see alignment E=2.4e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpf:Rpic12D_4205)

Predicted SEED Role

"Putative reductase (alkanesulfonate metabolism)" in subsystem Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>ABZR87_RS18330 fumarate reductase/succinate dehydrogenase flavoprotein subunit (Ralstonia sp. UNC404CL21Col)
MNTLELEYDLVVVGGGTAGPMAAIKAKERNPALRVLLIDKAHVKRSGAISMGMDGLNNAV
IPGHATPEQYTGEITLANDGIVDQSGVYAYAQHSFATIEQLDRWGVKFEKDETGDYAVKK
VHHMGSYVLPMPEGHDIKKVLYRQLKRARVEITNRIVVTRVLTDADGAACGVLGFDCRTA
DFLVVRAKAVVLSCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELSNLECFQI
NPLIKDYNGPACAYVTGPLGGYTANARGERFIQCDYWSGQMMWEFYQELQGGKGPVFLKL
DHLAEETIQTIETILHTNERPSRGRFHAGRGTDYRTQMVEMHISEIGFCSGHSASGVYVN
ARAETTVPGLYAAGDMAAVPHNYMLGAFTYGWFAGQNAADYIAGRQGDARVNDAQIERER
TRIFAPLQRDHGLAPAQVEYKLRRMVNDYLQPPKVTRKMEIGLRRFDEIAEDITHLHARN
PHELMRAMEVSFIRDCAEMAARASLFRTESRWGLYHHRVDYPERDDANWFCHTRLYKDAH
GAMASRKQAVEPYVIPVDVLGTDSYAHMRIPKAA