Protein Info for ABZR87_RS18235 in Ralstonia sp. UNC404CL21Col

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 12 to 203 (192 residues), 162.6 bits, see alignment E=1.7e-51 PF01370: Epimerase" amino acids 14 to 86 (73 residues), 22.3 bits, see alignment E=1.6e-08 PF08659: KR" amino acids 14 to 170 (157 residues), 25.9 bits, see alignment E=1.8e-09 PF13561: adh_short_C2" amino acids 21 to 252 (232 residues), 192.7 bits, see alignment E=1.5e-60

Best Hits

Swiss-Prot: 60% identical to XDH_CAUVN: D-xylose 1-dehydrogenase (xylB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: None (inferred from 96% identity to rpf:Rpic12D_4189)

Predicted SEED Role

"D-xylose 1-dehydrogenase (EC 1.1.1.175)" in subsystem Xylose utilization (EC 1.1.1.175)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.175

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>ABZR87_RS18235 SDR family oxidoreductase (Ralstonia sp. UNC404CL21Col)
MSYAIYPSLVNKNVVITGGGSGIGAAIVEGFAKQGARVTFLDIARADSEALATSLGECVH
PPVFRHCDLRDIDALNATFADIEADAGPIDVLINNAANDDRHQIGTVTPAYWDNRIEVNL
RHQFFCAQAVLPSMKKQGRGVILNLGSISWHLAQPDLAIYMTAKAGIEGLTRGLARDLGG
FGIRVNCIVPGAVRTPRQMALWQSPESEAKLLGEQCLHERVEPEHVARMALFLASDDAAR
CTAREYFVDGGWYGG