Protein Info for ABZR87_RS18075 in Ralstonia sp. UNC404CL21Col

Annotation: type III secretion system export apparatus subunit SctT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 69 to 95 (27 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 15 to 243 (229 residues), 203.2 bits, see alignment E=2.5e-64 PF01311: Bac_export_1" amino acids 15 to 247 (233 residues), 188.2 bits, see alignment E=9.2e-60

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 52% identity to bam:Bamb_4220)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>ABZR87_RS18075 type III secretion system export apparatus subunit SctT (Ralstonia sp. UNC404CL21Col)
MTPSFSGWMETGHSVTLVLPRLLPMFFVLPVFGERMLTGLVRNGLIAVVAMFISPLVPLS
VLGEQTPVMWMLLLIKEAALGLLLAMGASAMLWAVQNVGYLIDFQTGTGNATFFDPLSGQ
ESGPTASFLGFLAITLFLTGGGLHVVLGALFESYRVWPVQALLPDVHVALDQFVIREADS
IMTWTIKLAAPVVLLLLVVEIGLSAISRSVPQLNIFMFSQPIKSGLAMLMMVLFLQFLYD
ALRQFIDTDSGMRGLLQLLGFPAAGP