Protein Info for ABZR87_RS18015 in Ralstonia sp. UNC404CL21Col

Annotation: flagellar biosynthesis protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 33 to 50 (18 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 186 to 213 (28 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 351 (344 residues), 353.6 bits, see alignment E=5.9e-110 PF01312: Bac_export_2" amino acids 8 to 346 (339 residues), 390.3 bits, see alignment E=4.1e-121

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 97% identity to rpf:Rpic12D_4178)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>ABZR87_RS18015 flagellar biosynthesis protein FlhB (Ralstonia sp. UNC404CL21Col)
MSDDSDLEKTEPASPRRLEQAREEGDVPRSRELASFALTAVSAGGLWVMGDSIVRAASSF
LARCLEFHRYNYTSGQDQWNYVTGQFMPLALVLGGLMLMLVIAALSPLALTRGAISFKPL
APDISRLFKLQGLTRMFSLEGLMELPRLLIKLFLIAGVGWLLVRYYRGDLIELPQQDLGV
AMRDTLHVAGVAFLCMAAVMMLVAAVDVPLSLWQYARKHRMTKEEVRKEHRESEGDPHVK
GRIRNLQRQAAQRRMMADVPKADVIVTNPTHYAVALRYSEKEGGAPRVLAKGADMVAAKI
RELGTEHKIPILEAPPLARALYRHTEIGHQIPEALYAAVAEVLAYVYQLRRLHQVGGRVP
VRPTDLPVPADMDPGPQPGADDADDDVTGNA