Protein Info for ABZR87_RS17815 in Ralstonia sp. UNC404CL21Col

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 78 to 211 (134 residues), 99.7 bits, see alignment E=9.2e-33

Best Hits

Predicted SEED Role

"C-5 sterol desaturase (EC 1.3.-.-)" (EC 1.3.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.-.-

Use Curated BLAST to search for 1.3.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>ABZR87_RS17815 sterol desaturase family protein (Ralstonia sp. UNC404CL21Col)
MNAFALPLALMLGCVLLELAALKWWRGQPLPWRDVILNLNSGHVLMWLCRGVEVAGFTWL
YSHASLHWADGWHPVAGWAFTFVAWDLGFYWLHRMHHKLGFLWAIHAVHHEGEHFNLSLG
VRNAWLSSLTSLPFFVPLALLGVTPEMFVAVSGLHYSVQFYNHCGLVGRSGVLDRIMVTP
ANHRVHHGCNPEYIDRNFGGTLLVWDKLFGTYQRALADVPIRYGVHKPTHSDNPFWANVV
PALQWLGLRTPHLQRDTRATPAGWIATGGVLLFGVVIDYVRTDGLWPGHYWQAVWFVLIL
LLTLALGGLSDGRGWGRWLWPLLALALPMLMIGICGAGDALSDTLAVALGLHGLACGLWH
ALRTESPLSSSPHAESR