Protein Info for ABZR87_RS17770 in Ralstonia sp. UNC404CL21Col

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 13 to 432 (420 residues), 537.6 bits, see alignment E=1e-165 PF00296: Bac_luciferase" amino acids 37 to 388 (352 residues), 161.6 bits, see alignment E=1.6e-51

Best Hits

Swiss-Prot: 49% identical to NTAA_AMIAI: Nitrilotriacetate monooxygenase component A (ntaA) from Aminobacter aminovorans

KEGG orthology group: K00492, [EC: 1.14.13.-] (inferred from 81% identity to vpe:Varpa_4372)

MetaCyc: 49% identical to nitrilotriacetate monooxygenase A subunit (Aminobacter aminovorans)
RXN-9508 [EC: 1.14.14.10]

Predicted SEED Role

"Nitrilotriacetate monooxygenase component A (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.14.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>ABZR87_RS17770 LLM class flavin-dependent oxidoreductase (Ralstonia sp. UNC404CL21Col)
MSDTQVPRQLHLNVNILHSGFVPSAWRLAESDPYAFADVQHYVKVARIAEAAKFDAVFLA
DNAAIVDQIHFRPITALEPTVLLASIAAATTHIGLIGTASTSYNEPFNIARRFATLDHVS
GGRAGWNVVTTADLPSARNFGRDTVPDHTERYARADEFTSVVKDLWNSWEDDAFVGDKVG
GSFVDVRKVHPIAHRGEFFRVQGPLNLPRSPQGYPVLVQAGGSADGRELAARHAEAVFSA
SQGFEEALAYARGLKARAQALGRGPEAIRVLPGLTTIIGATQAQARARRDALVDLIPWDY
SLTRLAGTLGVPVERLQLDARLPDDLPLPNNGNGNHTFFNATLALARSQQLTVRELIREL
AGGGGHRVLVGTPEQIADDIEHWFRHGAADGFNLMPDALPGGLQDFVDGVVPILQQRGLF
RTEYAGHTLREHFGLARPVGRPTNRAAA