Protein Info for ABZR87_RS17610 in Ralstonia sp. UNC404CL21Col

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 62 to 78 (17 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 335 to 353 (19 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 392 to 420 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 34 to 378 (345 residues), 217.3 bits, see alignment E=2.9e-68 PF01740: STAS" amino acids 449 to 541 (93 residues), 40.2 bits, see alignment E=2.5e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to rpf:Rpic12D_4108)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (589 amino acids)

>ABZR87_RS17610 SulP family inorganic anion transporter (Ralstonia sp. UNC404CL21Col)
MPPSTEHPAAALQHPESFAPLDAPPQPPQQRVVRDVIAGFSIAGLLLPEAVAYAGIASLP
PQAGLIALMCGLVVYSLLGTSRFAIVSATSSSAAVLFATVLSEPGASGATALTMAAALII
ATGVLFILAGAARLGGMSDFIARPVLRGFTFGLALTIAIKQLPKILDVAVHHSDTPRVAL
DLIAGAAGANPYSAALGAVALALLFGLGRWGRIPATLVVIVLAIAAGYWVDWHAHGIAVV
GHIDLQNISFGVPDLGRAQWMQSAELGFALMLILYAESYGSIRNFALKHGDSISANRDLV
ALGCANLLSGLLHGMPVGAGYSATSANEAAGAQSRLAGLCAAAVVALIVWLFLPQLARIP
EPVLAAIVIFAVSHSLHPAVFKPYWAWRRDRLVVIAALLAVLVLGVLHGLLAAIGVSLLL
TLRQLSEPNVSVLGRLRESHDFVDVSLHPEAKPLPGVLIIRPEVPLFFANTERVLGKVRA
MLQQPHEPALRTIMLSLEETPDVDGSAIEALRIFAAECAARGLQLMLVRLKPRALTVLQR
ATDNTLRPEMLHELSVDECVQSLAAAPSTPAGAQVDKATASPSAPAPAD