Protein Info for ABZR87_RS17155 in Ralstonia sp. UNC404CL21Col

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 87 (45 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 141 to 145 (5 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 2 to 66 (65 residues), 55.5 bits, see alignment E=3.2e-19 PF00528: BPD_transp_1" amino acids 19 to 222 (204 residues), 49.5 bits, see alignment E=2.3e-17

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to rpf:Rpic12D_4038)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltJ (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>ABZR87_RS17155 amino acid ABC transporter permease (Ralstonia sp. UNC404CL21Col)
MLEGFGMTLLVSAAAIAGGLAIGLLLTALRASAQPWLHLPARALVAFLRKTPLLVQLFFW
YFGAAQLLGEDVVGAITGWGGIAVGAWRLPAPSFEFLAAAFGIALYAGAFFSEELRAGIR
AVPRGQREAALSLGFTPRAAFLRVVLPQALRVSALPLLGQCANTIKNTSLAMGIGLAELA
YSARQVETDTLLAFQAFAVATVLYAGLILLLQWAAPQLLRRLGWASTSTLPNGAPS